PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_66865.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family bZIP
Protein Properties Length: 268aa    MW: 29427.7 Da    PI: 5.4607
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_66865.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.22.4e-10125182562
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                   kr +r   NR +A rs +R+  +i+eLe kv+ L++e ++L  +l +l+  ++ l ++
  MLOC_66865.1 125 KRVKRVLANRQSAARSKERRMRYIAELEHKVQILQTEATTLSAQLTHLQRDSSGLATH 182
                   999*********************************************9888776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-15121185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.542123186IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.8E-11125179No hitNo description
PfamPF001701.6E-9125180IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.52E-11125175No hitNo description
CDDcd147037.04E-20126175No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MSMEGMDGLN SSDGDSRGSS MPPANGADSS ENESEDYGGV ESQVFLWGEA GKKRNADGEP  60
TAAAAARHAR SLSMDSLMGK LSFSANGGEP SKFSLEFGSG EFTPAEMKRI MADEKLAEMA  120
LADPKRVKRV LANRQSAARS KERRMRYIAE LEHKVQILQT EATTLSAQLT HLQRDSSGLA  180
THNNELKFRL QAMEQQAQLR DALNEALTGE VQRLKQSATS ERGGDAASSG GLAQQMQLRC  240
QNQMLEMHKQ QQIPFYQLEQ PEQTRESN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3668260.0AK366826.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2047D05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574243.21e-142PREDICTED: transcription factor RF2b-like
SwissprotQ69IL49e-49RF2A_ORYSJ; Transcription factor RF2a
TrEMBLM0Y8Z70.0M0Y8Z7_HORVD; Uncharacterized protein
STRINGMLOC_66865.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-67bZIP family protein